PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.E03208.1.p
Common NameEUGRSUZ_E03208, LOC104445221
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family VOZ
Protein Properties Length: 485aa    MW: 53738.2 Da    PI: 5.5344
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.E03208.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ447.61.4e-1372084241217
               VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaa 93 
                       pppsaflgpkcalwdc+rpaqg ew+qdycssfha+lalneg+pg++pvlrp+gi+lkdgllfaalsak+qgk+vgipecegaatakspwna+
  Eucgr.E03208.1.p 208 PPPSAFLGPKCALWDCPRPAQGLEWCQDYCSSFHAALALNEGPPGMSPVLRPGGIGLKDGLLFAALSAKAQGKDVGIPECEGAATAKSPWNAP 300
                       89******************************************************************************************* PP

               VOZ  94 elfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrle 186
                       elfdls+legetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvm+efgglkrsyymdpqp+++fewhlyeyein++da+alyrle
  Eucgr.E03208.1.p 301 ELFDLSVLEGETIREWLFFDKPRRAFESGNRKQRSLPDYSGRGWHESRKQVMNEFGGLKRSYYMDPQPLNHFEWHLYEYEINKYDACALYRLE 393
                       ********************************************************************************************* PP

               VOZ 187 lklvdekksakgkvskdsladlqkklgrlta 217
                       lklvd+kk++kg+v++dsladlqk++grlta
  Eucgr.E03208.1.p 394 LKLVDGKKNPKGRVANDSLADLQKQMGRLTA 424
                       *****************************97 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009408Biological Processresponse to heat
GO:0009414Biological Processresponse to water deprivation
GO:0009631Biological Processcold acclimation
GO:0009816Biological Processdefense response to bacterium, incompatible interaction
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 485 aa     Download sequence    Send to blast
MGKGSKNYCK SASHKLFKDK AKNRVDDLQG MFVDLQYARK ESRNVDVVVL EEQVHQMLRE  60
WKAELNEPSP ASSLQQGGSL ATFSSDICRL LQLCEEEDDA TSALTPPKAE PNDQNLNIGD  120
GTNLPEGLNS KPRPQKRCFP SADQCKDSHV AIGAAAIDSV DGINSLEQLQ FGLNQGFNQS  180
YYDNYNSTGF GGEDTMPHVT NCLPSICPPP SAFLGPKCAL WDCPRPAQGL EWCQDYCSSF  240
HAALALNEGP PGMSPVLRPG GIGLKDGLLF AALSAKAQGK DVGIPECEGA ATAKSPWNAP  300
ELFDLSVLEG ETIREWLFFD KPRRAFESGN RKQRSLPDYS GRGWHESRKQ VMNEFGGLKR  360
SYYMDPQPLN HFEWHLYEYE INKYDACALY RLELKLVDGK KNPKGRVAND SLADLQKQMG  420
RLTAEFPPDS KRSVKGRTKV NSKDSVGYMY SDQNHGAAAN EIVDYGLVSP YDYLVENKGE  480
YYVT*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.E03208.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010057344.10.0PREDICTED: transcription factor VOZ1 isoform X1
RefseqXP_010057345.10.0PREDICTED: transcription factor VOZ1 isoform X1
RefseqXP_010057346.10.0PREDICTED: transcription factor VOZ1 isoform X1
SwissprotQ9SGQ00.0VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A059C8K50.0A0A059C8K5_EUCGR; Uncharacterized protein
STRINGPOPTR_0004s05030.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM66672745
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.20.0vascular plant one zinc finger protein